Report for Sequence Feature Glyma05g37230
Feature Type: gene_model
Chromosome: Gm05
Start: 40844760
stop: 40845778
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g37230
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G64160 AT
Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein | chr1:23814063-23814611 FORWARD LENGTH=182
SoyBase E_val: 6.00E-57 ISS
GO:0006952 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response
SoyBase N/A ISS
GO:0009807 GO-bp
Annotation by Michelle Graham. GO Biological Process: lignan biosynthetic process
SoyBase N/A ISS
GO:1901599 GO-bp
Annotation by Michelle Graham. GO Biological Process: (-)-pinoresinol biosynthetic process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0042349 GO-mf
Annotation by Michelle Graham. GO Molecular Function: guiding stereospecific synthesis activity
SoyBase N/A ISS
PTHR21495 Panther
NUCLEOPORIN-RELATED
JGI ISS
PTHR21495:SF5 Panther
DISEASE RESISTANCE RESPONSE PROTEIN-RELATED
JGI ISS
PF03018 PFAM
Dirigent-like protein
JGI ISS
UniRef100_B9RCK7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance response protein, putative n=1 Tax=Ricinus communis RepID=B9RCK7_RICCO
SoyBase E_val: 3.00E-94 ISS
UniRef100_I1K6C3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1K6C3_SOYBN
SoyBase E_val: 2.00E-138 ISS
Expression Patterns of Glyma05g37230
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma05g37230
Paralog Evidence Comments
Glyma08g02330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g37230 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g213400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g37230
Coding sequences of Glyma05g37230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g37230.1 sequence type=CDS gene model=Glyma05g37230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGCTCACGACGAGGCTCGTTTCGGTTATCTTGTTCTTGCTAGTGATCAGGGTGGGATGTTCCGCTTCTCCACACCATTGGAGAAAAAAAAGGGTTGGCGAACCGTGCAAGAAGTTGGTGTTTTACTTCCACGACATAATTTACAACGGTCACAACGGCAAGAATGCGACTTCGGCAATTGTGGGCACACCCGCATGGGGCAACAGGACCATACTAGCGGGGCATAACCACTTCGGTGACGTGGTTGTGTTCGATGACCCCATCACCTTGGACAACAACTTGCACTCGCCACCGGTTGGACGTGCCCAAGGGTTCTACATTTACGATAAGAAGGACATTTTCACCGCTTGGCTTGGCTTCTCCTTTGTCTTCAACTCTACCCAGCTTAGGGGTACCATTAACTTCGCCGGTGCTGACCCTCTGATGAATAAGACCAGGGACATTTCGGTAATTGGAGGGACTGGTGACTTCTTCATGACTAGGGGTGTGGCCACTCTCTCTACGGATGCATTTGAAGGGGAAGTTTATTTCAGGCTTCGTGCGGATATTAACTTGTTCGAATGTTGGTGA
Predicted protein sequences of Glyma05g37230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g37230.1 sequence type=predicted peptide gene model=Glyma05g37230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MELTTRLVSVILFLLVIRVGCSASPHHWRKKRVGEPCKKLVFYFHDIIYNGHNGKNATSAIVGTPAWGNRTILAGHNHFGDVVVFDDPITLDNNLHSPPVGRAQGFYIYDKKDIFTAWLGFSFVFNSTQLRGTINFAGADPLMNKTRDISVIGGTGDFFMTRGVATLSTDAFEGEVYFRLRADINLFECW*
SoyBase
Follow us on Twitter @SoyBaseDatabase
